ys Substance P Acetate with high quality cas 33507-63-0 1.Basic information: Product Name: Substance P Acetate Molecular Formula: C63H98N18O13S Molecular Weight: 1347.63 Cas No: 33507-63-0 (net) Synonyms: Euler... Read More

2018-04-09 11:23:32

White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)
Contact Now

Sermorelin Acetate name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder ... Read More

2018-04-09 11:21:59

White color Factory Supply Protirelin Acetate,Thyrotropin-releasing hormone,Thyroliberin,cas 24305-27-9
Contact Now

Protirelin Acetate,Thyrotropin-releasing hormone,Thyroliberin,cas 24305-27-9 Name:Protirelin Acetate Cas No: 24305-27-9 Formula: C16H22N6O4 Molecular:362.38 Sequence: Pyr-His-Pro-NH2 Purity:98% Appearance: ... Read More

2018-04-09 11:19:22

White color Factory Supply Pramlintide Acetate,Triproamylin,cas 151126-32-8
Contact Now

Pramlintide Acetate,Triproamylin,cas 151126-32-8 Name:Pramlintide Acetate Cas No: 151126-32-8 Formula: C171H267N51O53S2 Molecular:3949.38 Pramlintide: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-(NH2) Amylin: ... Read More

2018-04-09 11:17:51

White color Factory Supply Peptide YY (human) Acetate,cas 118997-30-1
Contact Now

Peptide YY (human) Acetate,cas 118997-30-1 Peptide YY (human) Acetate Cas No: 118997-30-1 (net) Formula: C194H295N55O57 Molecular: 4309.81 Sequence:H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu... Read More

2018-04-09 11:16:10

White color High purity Octreotide Acetate powder from China Cas No: 83150-76-9
Contact Now

Octreotide Acetate Name:Octreotide Acetate Cas No: 83150-76-9 Formula: C49H66N10O10S2 Molecular:1019.28 Sequence:D-Phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-[(1R,2R)-2-hydroxy-1-... Read More

2018-04-09 11:12:31

White color Myelin Oligodendrocyte Glycoprotein / MOG35-55 Cas:2022956-48-3
Contact Now

MOG(35-55) 1.Basic information: Name:MOG(35-55) Synonym:MOG(35-55);MOG35-55;MOG 35-55;Myelin Oligodendrocyte Glycoprotein(35-55);Myelin Oligodendrocyte Glycoprotein35-55;Myelin Oligodendrocyte Glycoprotein 35... Read More

2018-04-09 11:06:17

White color API Lanreotide Acetate,cas108736-35-2 ,127984-74-1
Contact Now

API Lanreotide Acetate,cas108736-35-2 ,127984-74-1 Name: Lanreotide Acetate Cas No: 108736-35-2 (net), 127984-74-1 (acetate) Formula: C54H69N11O10S2 Molecular: 1096.34 Sequence: H-D-2-Nal-Cys-Tyr-D-Trp-Lys-Val... Read More

2018-04-09 10:38:34

White color Goserelin Acetate,Gosereline,Goserelinum,Goserelina
Contact Now

Goserelin Acetate,Gosereline,Goserelinum,Goserelina Cas No: 65807-02-5 (net), 145781-92-6 (acetate) Formula: C61H88N18O16 Molecular:1329.46 Sequence:His-Trp-Ser-Tyr-D-Ser(tBu)-Leu-Arg-Pro-Azgly-NH2 Purity:98% ... Read More

2018-04-09 10:36:38

White color Chinese manufacturer supply Gonadorelin Acetate / Gonadorelin CAS 34973-08-5 with competitive price
Contact Now

Gonadorelin Gonadorelin is a medicine that is the same as gonadotropin-releasing hormone (GnRH) that is naturally released from the hypothalamus gland. GnRH causes the pituitary gland to release other hormones ... Read More

2018-04-09 10:34:11

Page 33 of 35|< << 26 27 28 29 30 31 32 33 34 35 >> >|