Place of Origin: | China |
Brand Name: | Youngshe |
Certification: | / |
Model Number: | High quality |
Minimum Order Quantity: | 100mg |
---|---|
Price: | USD50-3000/g |
Packaging Details: | plastic bottle,1g/bottle, 10g/ bottle or according to the customer's requirements |
Delivery Time: | 3-5 working days |
Payment Terms: | L/C, T/T, Western Union, MoneyGram |
Supply Ability: | 300g/month |
Color: | White | Shelf Life: | Two Years |
---|---|---|---|
Purity: | 98% | Cas: | 114466-38-5(acetate) |
Sermorelin Acetate
name: Sermorelin Acetate
Cas No: 86168-78-7(net),114466-38-5(acetate)
Formula: C151H250N44O44S
Molecular:3417
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].
1. Send us your request
2.Confirm price,delivery time,payment term,your request and all details you care
3.Sign contract and issue invoice
4.Payment by your side
5.We arrange shipment immediately after confirm payment
6.Delivery( door to door,around 5 working days)
7.Follow-up service
1. Send us your request
2.Confirm price,delivery time,payment term,your request and all details you care
3.Sign contract and invoice
4.Payment by your side
5.We arrange shipment( immediately after confim payment)
6.Delivery( door to door,around 5 working days)
7.Follow-up service
1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.
Other hot peptides we offer: