Xenin 25, Xenopsin-related peptide and Proxenin,cas 144092-28-4 1.Basic information: Name: Xenin 25 Synonym: Xenin 25 acetate salt, Xenin; Xenopsin-related peptide; Coatomer subunit alpha; Alpha-coat protein; ... Read More

2018-04-23 15:14:02

White color peptides ACTH(1-39) and Corticotropin,cas 9002-60-2 with prompt delivery
Contact Now

ACTH(1-39) and Corticotropin,cas 9002-60-2,Adrenocorticotropin Name: ACTH(1-39), Corticotropin Cas No: 9002-60-2 Formula: C207H308N56O58S Molecular: 4541.0658 Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF ... Read More

2018-04-23 15:10:29

Chinese manufacturer directly supply white color peptides Ghrelin with prompt delivery
Contact Now

Ghrelin (mouse, rat) Name: Ghrelin (mouse, rat) CAS No. : 258338-12-4 Sequence: H-Gly-Ser-Ser(octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Lys-Ala-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg-OH ... Read More

2018-04-23 15:05:09

Chinese manufacturer directly supply white color peptides Cetrorelix Acetate CAS 12028 with prompt delivery
Contact Now

Cetrorelix Acetate Name:Cetrorelix Acetate Cas No: 120287-85-6 Formula: C72H96ClN17O16 Molecular:1491 Sequence:Ac-D-Nal-D-Cpa-Ser-Tyr-D-Cit-Leu-Arg-Pro-D-Ala-NH2 Purity:98% Appearance: white powder Source: ... Read More

2018-04-23 14:55:38

Chinese manufacturer directly supply white color Acadesine AICAR cas2629-69-2 from Youngshe
Contact Now

AICAR product Name: AICAR Alternate Name/Synonyms: 5-Aminoimidazole-4-carboxamide 1-β-D-ribofuranoside; AICA-Riboside; NSC 105823 Description: A cell- permeable activator of AMP-activated protein kinase (AMPK), ... Read More

2018-04-23 14:47:49

Peptide synthesis white color Endothelin-1 / 117399-94-7 with high quality from youngshe chem
Contact Now

Peptide synthesis white color Endothelin-1 / 117399-94-7 TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly-Glu-Gly-Val... Read More

2018-04-23 13:57:08

Chemical materials white color P21 Peptide Peptide 6c Ac-DGGL-NH2
Contact Now

Chemical materials P21 Peptide Peptide 6c Ac-DGGL-NH2 Name: P21 Peptide CAS No. : N/A Sequence: Ac–DGGL(A)G-NH2 Molecular formula: C30H54N6O5 Molecular weight : 579.3 Purity: >95.0% Source: synthetic Descriptio... Read More

2018-04-23 13:46:37

White color High pure Substance P Acetate with high quality cas 33507-63-0
Contact Now

ys Substance P Acetate with high quality cas 33507-63-0 1.Basic information: Product Name: Substance P Acetate Molecular Formula: C63H98N18O13S Molecular Weight: 1347.63 Cas No: 33507-63-0 (net) Synonyms: Euler... Read More

2018-04-09 11:23:32

White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)
Contact Now

Sermorelin Acetate name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder ... Read More

2018-04-09 11:21:59

White color Factory Supply Protirelin Acetate,Thyrotropin-releasing hormone,Thyroliberin,cas 24305-27-9
Contact Now

Protirelin Acetate,Thyrotropin-releasing hormone,Thyroliberin,cas 24305-27-9 Name:Protirelin Acetate Cas No: 24305-27-9 Formula: C16H22N6O4 Molecular:362.38 Sequence: Pyr-His-Pro-NH2 Purity:98% Appearance: ... Read More

2018-04-09 11:19:22

Page 33 of 35|< << 26 27 28 29 30 31 32 33 34 35 >> >|