Sales & Support: Request A Quote
Home ProductsOther peptides

White powder peptide FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

White powder peptide FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

    • White powder peptide  FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer
    • White powder peptide  FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer
    • White powder peptide  FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer
    • White powder peptide  FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer
    • White powder peptide  FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer
  • White powder peptide  FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

    Product Details:

    Place of Origin: China
    Brand Name: Youngshe
    Certification: /
    Model Number: High purity

    Payment & Shipping Terms:

    Minimum Order Quantity: 0.1g
    Price: USD1-6000
    Packaging Details: plastic bottle,1g/bottle,5g/bottle,10g/bottle, or according to the customer's request.
    Delivery Time: within 30 days
    Payment Terms: L/C, T/T, Western Union,Paypal
    Supply Ability: 200g/month
    Contact Now
    Detailed Product Description
    Shelf Life: 2 Years Purity:: 90%min
    Color: White Powder

    FOXO4-DRI 

     

    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

     

     

    FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

     

    Custom peptide Senolytics and FOXO4-D-Retro-Inverso(DRI)

     

    Order process

    1. Send us your request

    2.Confirm price,delivery time,payment term,your request and all details you care

    3.Sign contract and issue invoice

    4.Payment by your side

    5.We arrange shipment immediately after confirm payment

    6.Delivery( door to door,around 5 working days)

    7.Follow-up service

     

    White powder peptide  FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

     

    Packing

    1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.

     

     

     

    Company Information

    Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.

     

    YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.

     

    Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

     

     

    White powder peptide  FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

     

     

    Courier

    We will use your favorite courier,such as DHL,UPS,TNT,FEDEX or EMS. Shipping by Air is also available.

     

     

    White powder peptide  FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

     

    Please contact us by:

     

    Cecilia Jiang

    Ph:+86-18108235634

    What'sapp/We chat:+86-18108235634

    Contact Details
    Chengdu YoungShe Chemical Co., Ltd

    Contact Person: Miss. Cecilia Jiang

    Send your inquiry directly to us (0 / 3000)