Send Message
Sales & Support: Request A Quote
Home Products

Peptides Ingredients

All Products
Anti Wrinkle Peptide (101)
Peptide Hair Growth (33)
Skin Care Peptide (73)
Peptide For Eye Bags (6)
Skin Repair Peptide (33)
Peptides Ingredients (343)
Custom Peptide Synthesis (211)
Best Products
Good quality white color Epitalon / N-Acetyl Epitalon / N-Acetyl Epitalon Amidate

Good quality white color Epitalon / N-Acetyl Epitalon / N-Acetyl Epitalon Amidate

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

Pure Arg bpc-157 for bodybuilding purpose from Chinese factory

Pure Arg bpc-157 for bodybuilding purpose from Chinese factory

I'm Online Chat Now
China Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color distributor
Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color

Peptides Ingredients

(343)
China chemical material synthesis Teriparatide Acetate / CAS 52232-67-4 in white color factory

chemical material synthesis Teriparatide Acetate / CAS 52232-67-4 in white color
Contact Now

chemical material synthesis Teriparatide Acetate / CAS 52232-67-4 in white color Name:Teriparatide Acetate, Teriparatida , Teriparatidum Cas No: 52232-67-4(net),99294-94-7(acetate) Formula: C181H291N55O51S2 ... Read More
2018-05-11 14:20:42
China chemical material synthesis Teduglutide / CAS 197922-42-2 in white color factory

chemical material synthesis Teduglutide / CAS 197922-42-2 in white color
Contact Now

chemical material synthesis Teduglutide / CAS 197922-42-2 in white color Name: Teduglutide Cas No: 197922-42-2 Formula: C164H252N44O55S Molecular:3752 Sequence: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD Purity:98% ... Read More
2018-05-11 14:14:47
China chemical material synthesis Tetracosactide Acetate / CAS 16960-16-0 in white color factory

chemical material synthesis Tetracosactide Acetate / CAS 16960-16-0 in white color
Contact Now

Chemical material synthesis Tetracosactide Acetate / CAS 16960-16-0 in white color Name:Tetracosactide Acetate, Tetracosactida, Tetracosactidum Cas No:16960-16-0 (net), 60189-34-6 (acetate) Formula: C136H210N40... Read More
2018-05-11 14:09:45
China chemical material synthesis Triptorelin Acetate / CAS 57773-63-4 in white color factory

chemical material synthesis Triptorelin Acetate / CAS 57773-63-4 in white color
Contact Now

Chemical material synthesis Triptorelin Acetate / CAS 57773-63-4 in white color Name:Triptorelin Acetate, Triptoreline, Triptorelina, Triptorelinum Cas No:57773-63-4 (net), 140194-24-7 (acetate) Formula: ... Read More
2018-05-11 14:07:07
China chemical material synthesis Vapreotide Acetate / CAS 103222-11-3 in white color factory

chemical material synthesis Vapreotide Acetate / CAS 103222-11-3 in white color
Contact Now

Chemical material synthesis Vapreotide Acetate / CAS 103222-11-3 in white color Name:Vapreotide Acetate Cas No: 103222-11-3(net), 849479-74-9(acetate) Formula: C57H70N12O9S2 Molecular: 1131.371 Sequence: D-Phe-... Read More
2018-05-11 14:04:38
China chemical material synthesis Secretin Acetate / CAS 914454-02-7 in white color factory

chemical material synthesis Secretin Acetate / CAS 914454-02-7 in white color
Contact Now

chemical material synthesis Secretin Acetate / CAS 914454-02-7 in white color Name: Secretin Acetate Cas No: 914454-02-7 Formula: C132H224N44O42 Molecular: 3099.46 Sequence:His-ser-asp-gly-thr-phe-thr-ser-glu... Read More
2018-05-11 14:01:44
China chemical material synthesis Nifalatide / CAS 73385-60-1 in white color factory

chemical material synthesis Nifalatide / CAS 73385-60-1 in white color
Contact Now

chemical material synthesis Nifalatide / CAS 73385-60-1 in white color Name:Nifalatide Cas No: 73385-60-1 MF: C30H39N7O9S Molecular:673.74 Sequence: Tyr-Met(O)-Gly-(4-nitrophenyl)-Ala-Pro-NH2 Purity:98% ... Read More
2018-05-11 13:52:39
China chemical material synthesis ghrelin / Ghrelin (Human) powder / CAS 258279-04-8 in white color factory

chemical material synthesis ghrelin / Ghrelin (Human) powder / CAS 258279-04-8 in white color
Contact Now

chemical material synthesis ghrelin / Ghrelin (Human) powder / CAS 258279-04-8 in white color Name:Ghrelin(Rat) Cas No: 258338-12-4 Formula: C147H245N45O42 Molecular:3314.79 Sequence:Gly-Ser-Ser(n-octanoyl)-Phe... Read More
2018-05-11 13:50:01
China Custom peptides synthesis Taltirelin,taltirelin hydrate,cas 103300-74-9 in white color factory

Custom peptides synthesis Taltirelin,taltirelin hydrate,cas 103300-74-9 in white color
Contact Now

Taltirelin,taltirelin hydrate,cas 103300-74-9 Basic information: Product Name: Taltirelin Molecular Formula: C17H31N7O9 Molecular Weight: 477.46 Cas No: 103300-74-9 Synonyms: taltirelin hydrate; (1-methyl-4,5... Read More
2018-04-27 15:19:00
China White color peptides Somatostatin Acetate Cas 51110-01-1 with prompt delivery factory

White color peptides Somatostatin Acetate Cas 51110-01-1 with prompt delivery
Contact Now

White color peptides Somatostatin Acetate Cas 51110-01-1 with prompt delivery Name:Somatostatin Acetate Cas No: 38916-34-6(acetate), 51110-01-1 (net) Formula: C76H104N18O19S2 Molecular:1637.87 Sequence: Ala-Gly... Read More
2018-04-23 15:19:48
Page 31 of 35|< 26 27 28 29 30 31 32 33 34 35 >|
Peptide Hair Growth

High quality blue color cosmetic ingredient GHK-CU,Copper peptide

White Color Peptide Hair Growth No Side Effect Acetyl Tetrapeptide-3

Peptide Hair Growth White Powder Biotinoyl Tripeptide-1/Procapil

Skin Care Peptide

Cosmetic Skin Care Peptide Acetyl Hexapeptide-38 For Breast Enlargement

Peptides Ingredients

White powder peptide FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

White color Factory Supply good price Oxytocin / Oxytocin acetate

White color Custom peptide Deslorelin / Deslorelin Acetate for veterinary use

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

Request A Quote

E-Mail | Sitemap

Mobile Site
Privacy Policy | China Good Quality Anti Wrinkle Peptide Supplier. © 2017 - 2024 youngshececilia.com. All Rights Reserved.