Send Message
Sales & Support: Request A Quote
Home Products

Peptides Ingredients

All Products
Anti Wrinkle Peptide (101)
Peptide Hair Growth (33)
Skin Care Peptide (73)
Peptide For Eye Bags (6)
Skin Repair Peptide (33)
Peptides Ingredients (343)
Custom Peptide Synthesis (211)
Best Products
Good quality white color Epitalon / N-Acetyl Epitalon / N-Acetyl Epitalon Amidate

Good quality white color Epitalon / N-Acetyl Epitalon / N-Acetyl Epitalon Amidate

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

Pure Arg bpc-157 for bodybuilding purpose from Chinese factory

Pure Arg bpc-157 for bodybuilding purpose from Chinese factory

I'm Online Chat Now
China Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color distributor
Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color

Peptides Ingredients

(343)
China White color Opioid peptide Dynorphin A Dynorphin A(1-13) cas 72957-38-1 factory

White color Opioid peptide Dynorphin A Dynorphin A(1-13) cas 72957-38-1
Contact Now

Opioid peptide,Dynorphin A,Dynorphin A(1-13) Name: Dynorphin A CAS No. : 72957-38-1 Sequence: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys. Molecular formula: C75H126N24O15 Molecular weight : 1603.95 ... Read More
2018-04-09 10:31:40
China White color Buserelin Acetate / Buserelin with competitive price factory

White color Buserelin Acetate / Buserelin with competitive price
Contact Now

Buserelin Acetate, Buserelina,cas 57982-77-1 Name:Buserelin Acetate, Buserelina Cas No: 57982-77-1 (net), 68630-75-1 (acetate) Formular: C62H90N16O15 Molecular: 1299.47 Sequence:His-Trp-Ser-Tyr-D-Ser(tBu)-Leu... Read More
2018-04-09 10:22:58
China high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide factory

high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide
Contact Now

FOXO4-DRI Product Description FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity ... Read More
2018-03-01 14:50:53
China High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier factory

High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier
Contact Now

Sermorelin Acetate Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder ... Read More
2017-11-21 14:36:19
China White color API Pentadecapeptide bpc-157 for bodybuilding purpose from Chinese factory factory

White color API Pentadecapeptide bpc-157 for bodybuilding purpose from Chinese factory
Contact Now

Product Description Description BPC 157 (Body Protection Compound-157) is a pentadecapeptide made up of 15 amino acids. The amino acids sequence in BPC 157 is similar to a portion of the human BPC amino acid ... Read More
2017-11-15 16:26:19
China Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color factory

Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color
Contact Now

[Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer Name: HNG Peptide (human) CAS No. : 330936-70-4 Sequence:H-Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val... Read More
2017-11-15 15:45:38
China High quality GHRP-6 Acetate,Growth hormone releasing hexapeptide in white color factory

High quality GHRP-6 Acetate,Growth hormone releasing hexapeptide in white color
Contact Now

GHRP-6 Acetate Formula: C46H56N12O6 Molecular:873 Sequence: His-Trp-Ala-Trp-Phe-LysNH2 Purity:98% Appearance: white powder Source: synthetic Formula: C46H56N12O6 Molecular:873 Also known as: growth hormone ... Read More
2017-11-15 15:34:40
China High purity peptide Dynorphin A Dynorphin A(1-13) cas 72957-38-1 in white color from good supplier factory

High purity peptide Dynorphin A Dynorphin A(1-13) cas 72957-38-1 in white color from good supplier
Contact Now

Opioid peptide,Dynorphin A,Dynorphin A(1-13) Name: Dynorphin A CAS No. : 72957-38-1 Sequence: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys. Molecular formula: C75H126N24O15 Molecular weight : 1603.95 ... Read More
2017-11-15 15:28:45
China White color Pentadecapeptide bpc-157 for bodybuilding purpose in pahrm grade from Chinese factory factory

White color Pentadecapeptide bpc-157 for bodybuilding purpose in pahrm grade from Chinese factory
Contact Now

Pentadecapeptide BPC 157 Peptide sequence: GEPPPGKPADDAGLV Cas No.: 137525-51-0 Appearance: white powder Purity: >95% M.F: C62H98N16O22 M.W: 1419.55 Capacity: 100g per month Bpc 157: specifications Sequence: L... Read More
2017-11-15 14:17:49
China White color Peptide Liraglutide DMF preparation cas204656-20-2 from Chinese reliable supplier factory

White color Peptide Liraglutide DMF preparation cas204656-20-2 from Chinese reliable supplier
Contact Now

GMP grade Liraglutide Name:Liraglutide Reference: Saxenda CAS: 204656-20-2 (net) Formula:C172H265N43O51 Molecular:3751. 26 Sequence:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala... Read More
2017-11-15 14:17:49
Page 34 of 35|< 26 27 28 29 30 31 32 33 34 35 >|
Peptide Hair Growth

High quality blue color cosmetic ingredient GHK-CU,Copper peptide

White Color Peptide Hair Growth No Side Effect Acetyl Tetrapeptide-3

Peptide Hair Growth White Powder Biotinoyl Tripeptide-1/Procapil

Skin Care Peptide

Cosmetic Skin Care Peptide Acetyl Hexapeptide-38 For Breast Enlargement

Peptides Ingredients

White powder peptide FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

White color Factory Supply good price Oxytocin / Oxytocin acetate

White color Custom peptide Deslorelin / Deslorelin Acetate for veterinary use

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

Request A Quote

E-Mail | Sitemap

Mobile Site
Privacy Policy | China Good Quality Anti Wrinkle Peptide Supplier. © 2017 - 2024 youngshececilia.com. All Rights Reserved.