Pramlintide Acetate,Triproamylin,cas 151126-32-8 Name:Pramlintide Acetate Cas No: 151126-32-8 Formula: C171H267N51O53S2 Molecular:3949.38 Pramlintide: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-(NH2) Amylin: ... Read More

2018-04-09 11:17:51

White color Myelin Oligodendrocyte Glycoprotein / MOG35-55 Cas:2022956-48-3
Contact Now

MOG(35-55) 1.Basic information: Name:MOG(35-55) Synonym:MOG(35-55);MOG35-55;MOG 35-55;Myelin Oligodendrocyte Glycoprotein(35-55);Myelin Oligodendrocyte Glycoprotein35-55;Myelin Oligodendrocyte Glycoprotein 35... Read More

2018-04-09 11:06:17

White color API Lanreotide Acetate,cas108736-35-2 ,127984-74-1
Contact Now

API Lanreotide Acetate,cas108736-35-2 ,127984-74-1 Name: Lanreotide Acetate Cas No: 108736-35-2 (net), 127984-74-1 (acetate) Formula: C54H69N11O10S2 Molecular: 1096.34 Sequence: H-D-2-Nal-Cys-Tyr-D-Trp-Lys-Val... Read More

2018-04-09 10:38:34

White color Goserelin Acetate,Gosereline,Goserelinum,Goserelina
Contact Now

Goserelin Acetate,Gosereline,Goserelinum,Goserelina Cas No: 65807-02-5 (net), 145781-92-6 (acetate) Formula: C61H88N18O16 Molecular:1329.46 Sequence:His-Trp-Ser-Tyr-D-Ser(tBu)-Leu-Arg-Pro-Azgly-NH2 Purity:98% ... Read More

2018-04-09 10:36:38

White color Chinese manufacturer supply Gonadorelin Acetate / Gonadorelin CAS 34973-08-5 with competitive price
Contact Now

Gonadorelin Gonadorelin is a medicine that is the same as gonadotropin-releasing hormone (GnRH) that is naturally released from the hypothalamus gland. GnRH causes the pituitary gland to release other hormones ... Read More

2018-04-09 10:34:11

White color Opioid peptide Dynorphin A Dynorphin A(1-13) cas 72957-38-1
Contact Now

Opioid peptide,Dynorphin A,Dynorphin A(1-13) Name: Dynorphin A CAS No. : 72957-38-1 Sequence: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys. Molecular formula: C75H126N24O15 Molecular weight : 1603.95 ... Read More

2018-04-09 10:31:40

High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier
Contact Now

Sermorelin Acetate Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder ... Read More

2017-11-21 14:36:19

Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color
Contact Now

[Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer Name: HNG Peptide (human) CAS No. : 330936-70-4 Sequence:H-Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val... Read More

2017-11-15 15:45:38

High purity peptide Dynorphin A Dynorphin A(1-13) cas 72957-38-1 in white color from good supplier
Contact Now

2017-11-15 15:28:45

White color Peptide Liraglutide DMF preparation cas204656-20-2 from Chinese reliable supplier
Contact Now

GMP grade Liraglutide Name:Liraglutide Reference: Saxenda CAS: 204656-20-2 (net) Formula:C172H265N43O51 Molecular:3751. 26 Sequence:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala... Read More

2017-11-15 14:17:49

Page 34 of 35|< << 26 27 28 29 30 31 32 33 34 35 >> >|