 |
| Place of Origin: | China |
| Brand Name: | Youngshe |
| Certification: | / |
| Model Number: | High quality |
| Minimum Order Quantity: | 100mg |
|---|---|
| Price: | USD50-300/g |
| Packaging Details: | plastic bottle,1g/bottle, 10g/ bottle or according to the customer's requirements |
| Delivery Time: | 3-5 working days |
| Payment Terms: | L/C, T/T, Western Union, MoneyGram |
| Supply Ability: | 300g/month |
| Color: | White | Shelf Life: | Two Years |
|---|---|---|---|
| Purity: | 98% |
ACTH(1-39) and Corticotropin,cas 9002-60-2,Adrenocorticotropin
Name: ACTH(1-39), Corticotropin
Cas No: 9002-60-2
Formula: C207H308N56O58S
Molecular: 4541.0658
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Adrenocorticotropin, ACTH, Corticotrophine, Corticotrofina, Cortrophin, Corticotrophinum
1. Send us your request
2.Confirm price,delivery time,payment term,your request and all details you care
3.Sign contract and invoice
4.Payment by your side
5.We arrange shipment( immediately after confim payment)
6.Delivery( door to door,around 5 working days)
7.Follow-up service
1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.
Other hot peptides we offer:
