logo
Send Message
Home ProductsPeptides Ingredients

White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)

White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)

    • White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)
    • White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)
    • White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)
    • White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)
  • White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)

    Product Details:

    Place of Origin: China
    Brand Name: Youngshe
    Certification: /
    Model Number: High quality

    Payment & Shipping Terms:

    Minimum Order Quantity: 100mg
    Price: USD50-3000/g
    Packaging Details: plastic bottle,1g/bottle, 10g/ bottle or according to the customer's requirements
    Delivery Time: 3-5 working days
    Payment Terms: L/C, T/T, Western Union, MoneyGram
    Supply Ability: 300g/month
    Contact Now
    Detailed Product Description
    Color: White Shelf Life: Two Years
    Purity: 98% Cas: 114466-38-5(acetate)

    Sermorelin Acetate

     

     

     

    name: Sermorelin Acetate

    Cas No: 86168-78-7(net),114466-38-5(acetate)

    Formula: C151H250N44O44S

    Molecular:3417

    Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

    Purity:98%

    Appearance: white powder

    Source: synthetic

    Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

     

     

     

    Custom peptide Pharmaceutical intermediates Desmopressin / Desmopressin Acetate with high purity

     

     

    Order process

    1. Send us your request

    2.Confirm price,delivery time,payment term,your request and all details you care

    3.Sign contract and issue invoice

    4.Payment by your side

    5.We arrange shipment immediately after confirm payment

    6.Delivery( door to door,around 5 working days)

    7.Follow-up service

     

     

     

    Order process

    1. Send us your request

    2.Confirm price,delivery time,payment term,your request and all details you care

    3.Sign contract and invoice

    4.Payment by your side

    5.We arrange shipment( immediately after confim payment)

    6.Delivery( door to door,around 5 working days)

    7.Follow-up service

     

     

    Packing

    1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.

     

     

    Other hot peptides we offer:

    ---------------------------------------------------------------------------------
    Instant anti-winkle:
     
    1. Acetyl Hexapeptide-8 (Argireline)
    2. Acetyl Octapeptide-3 (SNAP-8)
    3. Pentapeptide-18 (Leuphasyl)
    4. Pentapeptide-3 (Vialox)
    5. Dipeptide Diaminobutyroyl Benzylamide Diacetate (SYN-AKE)
    --------------------------------------------------------------------------------
    Boost Collagen,Laminin,Fibronectin,Inergrin,Elastin,Hyaluronic acid and Glycosaminoglycan synthesis :
     
    1. Tetrapeptide-21 (TEGO Pep4-17)
    2. Acetyl Tetrapeptide-9 (Dermican)
    3. Palmitoyl Pentapeptide-3 (Matrixyl)
    4. Palmitoyl Oligopeptide+Palmitoyl Tetrapeptide-7 (Matrixyl3000)
    5. Palmtoyl Tripeptide-38 (Matrixyl synthe6)
    6. Palmitoyl Hexapeptide-12 (Biopeptide EL)
     
    --------------------------------------------------------------------------------
    Skin brighten and whiten:
     
    1. Dipeptide (Genowhite)
    2. Tetrapeptide-30 (TEGO Pep4-even)
    3. Nonapeptide-1 (Melanostatine)
    4. Decapeptide-12 (Lumixyl)
    5. Hexapeptide-2 (Dermostatyl)
    6. Oligopeptide-68 (Beta-white)
    ----------------------------------------------------------------------------
    Stimulate Hair,eyelash and brow growth; anti-hair loss and hair pigmentation:
     
    1. Copper peptide
    2. Biotinoyl Tripeptide-1
    3. Acetyl Tetrapeptide-3 (Capixyl)
    4. Myristoyl Tetrapeptide-12
    5. Myristoyl Pentapeptide-17
    6. Decapeptide-10
    7. Decapeptide-18
    8. Oligopeptide-54
    9. Acetyl Hexapeptide-1 (Melitane)
    -------------------------------------------------------------------------
    Reduce eyebag and dark circle:
     
    1. Acetyl Tetrapeptide-5 (Eyeseryl)
    2. Dipeptide-2+Palmitoyl Tetrapeptide-7 (Eyeliss)
    -------------------------------------------------------------------------
    Anti-cellulite and Stretch marks:
     
    1. Acetyl Hexapeptide-39 (Silusyne)
    2. Pentapeptide-25 (UCPEPTIDE V)
    3. Palmitoyl Tripeptide-5 (SYN-Coll)
    4. Pentapeptide-18+Peptide AC-29 (Vanistryl)
    -------------------------------------------------------------------------
    Improve skin elasticity and firmness:
     
    1. Acetyl Tetrapeptide-2 (Uplevity)
    2. Acetyl Tetrapeptide-9 (Dermican)
    2. Hexapeptide-10 (Serilesine)
    3. Acetyl Dipeptide-13 DIPHENYLGLYCINE (Relistase)
    4. Palmitoyl Oligopeptide (Biopeptide EL)
    5. Palmitoyl Tetrapeptide-3 (Rigin)
    6. Trifluoroacetyl Tripeptide-2 (Progeline)
    7. Trippetide-10 Citrulline (Decorinyl)
     
    .......
     
    For more peptide information,please contact:
    White color High pure Sermorelin Acetate powder with fast delivery from China, 114466-38-5 (acetate)

     

     

     

    Contact Details
    Chengdu YoungShe Chemical Co., Ltd

    Contact Person: Cecilia Jiang

    Tel: +8618108235634

    Send your inquiry directly to us (0 / 3000)