logo
Send Message
Home Products

Peptides Ingredients

I'm Online Chat Now

Peptides Ingredients

(341)
China Cosmetic white powder Acetyl Tetrapeptide-22/Thermostressine for skin relaxing factory

Cosmetic white powder Acetyl Tetrapeptide-22/Thermostressine for skin relaxing

Acetyl Tetrapeptide-22 1.Basic information of Acetyl Tetrapeptide-22: INCI Name: Acetyl Tetrapeptide-22 Reference:Thermostressine Purity:>95% Source: synthetic Grade: cosmetic Formulation: available for your ... Read More
2023-10-31 09:42:14
China White color high quality skin barrier and immune Pentapeptide-31 from China factory

White color high quality skin barrier and immune Pentapeptide-31 from China

Pentapeptide-31 1.Basic information: INCI name: Pentapeptide-31 Reference: Survixyl IS Cas No: EINECS number: Formula: Molecular: Purity: >95% Source: synthetic Grade: cosmetic Stability: stable Solubility: ... Read More
2023-10-31 09:42:14
China 2017 hot sale water binding peptide white color Tripeptide-32 from Sichuan manufacturer factory

2017 hot sale water binding peptide white color Tripeptide-32 from Sichuan manufacturer

Tripeptide-32 1.Basic information: INCI name: Tripeptide-32 Molecular: MF: Reference: estee lauder advanced night repair, Chronolux Solubility: soluble in water Stability: stable COA and MSDS: available for ... Read More
2023-10-31 09:42:14
China White color Acetyl Hexapeptide-1 Melitane for melanin synthesis Stimulating factory

White color Acetyl Hexapeptide-1 Melitane for melanin synthesis Stimulating

White color Acetyl Hexapeptide-1 Melitane for melanin synthesis Stimulating 1.Basic information: Name:Acetyl Hexapeptide-1 Reference: Melitane Formula: C43H59N13O7 Molecular:870 Purity: >95% Source: synthetic ... Read More
2023-10-31 09:42:14
China White color energy-boosting peptide Tripeptide-3 AT Peptide IS from Chinese supplier factory

White color energy-boosting peptide Tripeptide-3 AT Peptide IS from Chinese supplier

White color energy-boosting peptide Tripeptide-3 AT Peptide IS from Chinese supplier 1.Basic information: INCI Name: Tripeptide-3 Reference: AT Peptide IS Formula: C14H24N8O4 Molecular: 368 Purity: 95%min ... Read More
2023-10-31 09:42:13
China White color Gene custom peptide Synthesis Services from Chengdu Youngshe Chem factory

White color Gene custom peptide Synthesis Services from Chengdu Youngshe Chem

Gene Synthesis Services Gene Synthesis Gene synthesis is an efficient and cost-effective alternative to molecular cloning for custom gene production. We can synthesize codon-optimized cDNA, gene variants, ... Read More
2023-10-31 09:42:13
China Melanophore-Stimulating Hormone,LS-187036,Melanotropin,cas 581-05-5 in white color factory

Melanophore-Stimulating Hormone,LS-187036,Melanotropin,cas 581-05-5 in white color

α-Melanotropin (human) Acetate 1.Basic information: Product Name:α-Melanotropin (human) Acetate Synonym: α-MSH; α-Melanocyte-stimulating hormone;Melanophore-Stimulating Hormone;Melanophore Stimulating Hormone;α ... Read More
2023-10-31 09:42:13
China White color high pure Sermorelin Acetate powder with fast delivery from China factory

White color high pure Sermorelin Acetate powder with fast delivery from China

Sermorelin Acetate name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder ... Read More
2023-10-31 09:42:13
China Manufacturer supply HNG Peptide (human)/S14G-Humanin CAS 330936-70-4 with high purity in white color factory

Manufacturer supply HNG Peptide (human)/S14G-Humanin CAS 330936-70-4 with high purity in white color

Manufacturer supply HNG Peptide (human)/S14G-Humanin CAS 330936-70-4 Name: HNG Peptide (human) CAS No. : 330936-70-4 Sequence:H-Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val... Read More
2023-10-31 09:42:13
China White color Palmitoyl Tripeptide-30 melatime for DNA damage and UV damage from reliable Chinese manufacturer factory

White color Palmitoyl Tripeptide-30 melatime for DNA damage and UV damage from reliable Chinese manufacturer

White color Palmitoyl Tripeptide-30 melatime for DNA damage and UV damage from reliable Chinese manufacturer 1.Basic information: INCI name: Palmitoyl Tripeptide-30 Reference: melatime Purity: >95% Grade: ... Read More
2023-10-31 09:42:06
Page 7 of 35|< 2 3 4 5 6 7 8 9 10 11 >|