logo
Send Message
Home ProductsPeptides Ingredients

White color high pure Sermorelin Acetate powder with fast delivery from China

White color high pure Sermorelin Acetate powder with fast delivery from China

    • White color high pure Sermorelin Acetate powder with fast delivery from China
    • White color high pure Sermorelin Acetate powder with fast delivery from China
    • White color high pure Sermorelin Acetate powder with fast delivery from China
    • White color high pure Sermorelin Acetate powder with fast delivery from China
  • White color high pure Sermorelin Acetate powder with fast delivery from China

    Product Details:

    Place of Origin: China
    Brand Name: Youngshe
    Certification: /
    Model Number: high quality

    Payment & Shipping Terms:

    Minimum Order Quantity: 1g
    Price: USD100-5000/g
    Packaging Details: 1g/bottle or customized
    Delivery Time: 3-5 working days
    Payment Terms: L/C, T/T, Western Union, MoneyGram,Paypal
    Supply Ability: 500g/month
    Contact Now
    Detailed Product Description
    Other Names:: Sermorelin Acetate MF:: C151H250N44O44S
    Color: White Shelf Life: 2 Years

    Sermorelin Acetate

     

     

     

    name: Sermorelin Acetate

    Cas No: 86168-78-7(net),114466-38-5(acetate)

    Formula: C151H250N44O44S

    Molecular:3417

    Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

    Purity:98%

    Appearance: white powder

    Source: synthetic

     

     

    Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

     

    White color high pure Sermorelin Acetate powder with fast delivery from China

     

    Others:

    Payment: T/T,PayPal,Western Union,MoneyGram,L/C,ESCROW

    Delivery time : Around 3-5 working days after your payment.

    In stock: Yes

    Capacity: bulk

    Reference price: please inquiry

    Sample: please inquiry

    Guarantee: Full refund if you met any quality problem

    Packing Detail: 1g/bottle or according to your request

    Storage Situation: sealed, keep it in refrigerator at 2-8 degrees Celsius

    Shelf Life: Two years

     

     

    Others:

    Payment: T/T,PayPal,Western Union,MoneyGram,L/C,ESCROW

    Delivery time : Around 3-5 working days after your payment

    In stock: Yes

    Capacity: bulk

    Reference price: please inquiry

    Sample: please inquiry

    Guarantee: Full refund if you met any quality problem

    Packing Detail: 1g/bottle or according to your request

    Storage Situation: sealed, keep it in refrigerator at 2-8 degrees Celsius

    Shelf Life: Two years

     

     

     

    Order process

    1. Send us your request

    2.Confirm price,delivery time,payment term,your request and all details you care

    3.Sign contract and issue invoice

    4.Payment by your side

    5.We arrange shipment immediately after confirm payment

    6.Delivery( door to door,around 5 working days)

    7.Follow-up service

     

    Packing

    1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.

     

     

     

    Company Information

    Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.

     

    YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.

     

    Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

     

     

    Other peptide APIs we have:

     

     

    GHRP-6 Acetate

    GHRP-2 Acetate

    Ipamorelin

    Hexarelin

    MGF

    Melanotan2

    PT141

    CJC-1295

    Semax

    Acetyl Semax

    Acetyl Semax Amide

    Selank

    Acetyl Selank Amide

    Epithalon

    BPC157 peptide

     

    White color high pure Sermorelin Acetate powder with fast delivery from China

    Contact Details
    Chengdu YoungShe Chemical Co., Ltd

    Contact Person: Cecilia Jiang

    Tel: +8618108235634

    Send your inquiry directly to us (0 / 3000)