| Place of Origin: | China |
| Brand Name: | Youngshe |
| Certification: | / |
| Model Number: | high quality |
| Minimum Order Quantity: | 1g |
|---|---|
| Price: | USD100-5000/g |
| Packaging Details: | 1g/bottle or customized |
| Delivery Time: | 3-5 working days |
| Payment Terms: | L/C, T/T, Western Union, MoneyGram,Paypal |
| Supply Ability: | 500g/month |
| Other Names:: | Sermorelin Acetate | MF:: | C151H250N44O44S |
|---|---|---|---|
| Color: | White | Shelf Life: | 2 Years |
Sermorelin Acetate
|
name: Sermorelin Acetate |
|
Cas No: 86168-78-7(net),114466-38-5(acetate) |
|
Formula: C151H250N44O44S |
|
Molecular:3417 |
|
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ |
|
Purity:98% |
|
Appearance: white powder |
|
Source: synthetic |
Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].
![]()
Others:
Payment: T/T,PayPal,Western Union,MoneyGram,L/C,ESCROW
Delivery time : Around 3-5 working days after your payment.
In stock: Yes
Capacity: bulk
Reference price: please inquiry
Sample: please inquiry
Guarantee: Full refund if you met any quality problem
Packing Detail: 1g/bottle or according to your request
Storage Situation: sealed, keep it in refrigerator at 2-8 degrees Celsius
Shelf Life: Two years
Others:
Payment: T/T,PayPal,Western Union,MoneyGram,L/C,ESCROW
Delivery time : Around 3-5 working days after your payment
In stock: Yes
Capacity: bulk
Reference price: please inquiry
Sample: please inquiry
Guarantee: Full refund if you met any quality problem
Packing Detail: 1g/bottle or according to your request
Storage Situation: sealed, keep it in refrigerator at 2-8 degrees Celsius
Shelf Life: Two years
1. Send us your request
2.Confirm price,delivery time,payment term,your request and all details you care
3.Sign contract and issue invoice
4.Payment by your side
5.We arrange shipment immediately after confirm payment
6.Delivery( door to door,around 5 working days)
7.Follow-up service
1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.
Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.
YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.
Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
Other peptide APIs we have:
GHRP-6 Acetate
GHRP-2 Acetate
Ipamorelin
Hexarelin
MGF
Melanotan2
PT141
CJC-1295
Semax
Acetyl Semax
Acetyl Semax Amide
Selank
Acetyl Selank Amide
Epithalon
BPC157 peptide
![]()