White color peptides Custom peptide service GLYX-13 and GLYX13,cas 117928-94-6 with prompt delivery Name: GLYX-13 CAS No. : 117928-94-6 Sequence: Thr-Pro-Pro-Thr-NH2 Molecular formula: C20H35N5O8 Molecular ... Read More

2024-10-14 09:20:30

Good quality white color LVY-AMC,CAS 76524-85-1 Youngshe Chem
Contact Now

Good quality white color LVY-AMC,CAS 76524-85-1 Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly-Glu-Gly... Read More

2024-10-14 09:15:14

Good quality white color Atriopeptin I (rat),CAS 89139-53-7 from Chengdu Youngshe Chem
Contact Now

Good quality white color Atriopeptin I (rat),CAS 89139-53-7 from Chengdu Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu... Read More

2024-10-14 09:14:57

White color High purity Octreotide Acetate powder from China Cas No: 83150-76-9
Contact Now

Octreotide Acetate Name:Octreotide Acetate Cas No: 83150-76-9 Formula: C49H66N10O10S2 Molecular:1019.28 Sequence:D-Phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-N-[(1R,2R)-2-hydroxy-1-... Read More

2024-10-14 09:14:27

Good quality white colorTRAP-14 amide,CAS141923-36-6 Youngshe Chem
Contact Now

Good quality white colorTRAP-14 amide,CAS141923-36-6 Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly-Glu... Read More

2024-10-14 09:14:11

White color Pentadecapeptide bpc-157 for bodybuilding purpose in pahrm grade from Chinese factory
Contact Now

Pentadecapeptide BPC 157 Peptide sequence: GEPPPGKPADDAGLV Cas No.: 137525-51-0 Appearance: white powder Purity: >95% M.F: C62H98N16O22 M.W: 1419.55 Capacity: 100g per month Bpc 157: specifications Sequence: L... Read More

2024-10-14 09:13:43

Good quality white color Suc-AKPF-pNA,CAS 128802-74-4 Youngshe Chem
Contact Now

Good quality white color Suc-AKPF-pNA,CAS 128802-74-4 Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly... Read More

2024-10-14 09:13:12

Custom peptide white color Recombinant Staphylococcal Protein A
Contact Now

Product Information Product Name: Recombinant Staphylococcal Protein A (r-SPA) Packing Details: 1 mg, 10 mg, 100 mg, 500 mg Formulation: Lyophilized from 5 mM PB, pH 7.4. Mol. Wt.: 30 kDa Resources: Escherichia ... Read More

2024-10-10 13:59:09

Custom peptide white color Recombinant Core Streptavidin
Contact Now

Product Information Product Name: Recombinant Core Streptavidin (rc-SA) Packing Details: 1 mg, 10 mg, 100 mg, 500 mg Formulation: Lyophilized from 5 mM PB, pH7.4 Mol. Wt.: 13.5 kDa for subunit and 54 kDa for ... Read More

2024-10-10 13:58:40

White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer
Contact Now

White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98... Read More

2024-10-10 13:56:36

Page 2 of 35|< << 1 2 3 4 5 6 7 8 9 10 >> >|