| Place of Origin: | China |
| Brand Name: | Youngshe |
| Certification: | / |
| Model Number: | High quality |
| Minimum Order Quantity: | 100mg |
|---|---|
| Price: | USD50-3000/g |
| Packaging Details: | plastic bottle,1g/bottle, 10g/ bottle or according to the customer's requirements |
| Delivery Time: | 3-5 working days |
| Payment Terms: | L/C, T/T, Western Union, MoneyGram |
| Supply Ability: | 300g/month |
| Color: | White | Shelf Life: | Two Years |
|---|---|---|---|
| Purity: | 98% |
White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer
Cas No:141732-76-5
Formula: C186H286N50O62S
Molecular:4246.62
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Purity:98%
Appearance: white powder
Source: synthetic
Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4
![]()
| ACTH (4-9) | 56236-83-0 | H-Met-Glu-His-Phe-Arg-Trp-OH |
| (Met(O)4,D-Lys8,Phe9)-ACTH (4-9) | 50913-93-4 | H-Met(O)-Glu-His-Phe-D-Lys-Phe-OH |
| Tyr-ACTH (4-9) | 129813-57-6 | H-Tyr-Met-Glu-His-Phe-Arg-Trp-OH |
| ACTH (4-10), α-MSH (4-10) | 4037-1-8 | H-Met-Glu-His-Phe-Arg-Trp-Gly-OH |
| Tyr-ACTH (4-10) | 131374-17-9 | H-Tyr-Met-Glu-His-Phe-Arg-Trp-Gly-OH |
| ACTH (4-11) | 67224-41-3 | H-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-OH |
| ACTH (5-10) | 4086-29-7 | H-Glu-His-Phe-Arg-Trp-Gly-OH |
| ACTH (7-38) (human) | 68563-24-6 | H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH |
| ACTH (11-24) | 4237-93-8 | H-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH |
| ACTH (18-39) (human) | 53917-42-3 | H-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH |
| ACTH (22-39) | 37548-29-1 | H-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH |
| ACTH (34-39) | 69454-10-0 | H-Ala-Phe-Pro-Leu-Glu-Phe-OH |
| ACV | 32467-88-2 | H-Aad(Cys-D-Val-OH)-OH |
| Acyl Carrier Protein (ACP) (65-74) (acid) | 66851-75-0 | H-Val-Gln-Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly-OH |
| Adipokinetic Hormone | 99886-31-4 | Pyr-Leu-Thr-Phe-Thr-Ser-Ser-Trp-Gly-NH2 |
| H-Ala-D-Isogln-OH | 45159-25-9 | H-Ala-D-Glu-NH2 |
| H-Ala-Glu(OtBu)-NH2 • HCl | 108607-07-4 | H-Ala-Glu(OtBu)-NH2 · HCl |
| Boc-Ala-D-Glu-NH2 | 18814-50-1 | Boc-Ala-D-Glu-NH2 |
| Boc-Ala-D-Glu-Obzl | 50515-48-5 | Boc-Ala-D-Glu-Obzl |
| Boc-Ala-D-Glu(OBzl)-NH2 | 18814-49-8 | Boc-Ala-D-Glu(OBzl)-NH2 |
1. Send us your request
2.Confirm price,delivery time,payment term,your request and all details you care
3.Sign contract and invoice
4.Payment by your side
5.We arrange shipment( immediately after confim payment)
6.Delivery( door to door,around 5 working days)
7.Follow-up service
1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.
We are a professional Peptide Manufacturer in China. We can do :
1. Custom peptide synthesis ( long peptide sequence up to 200AA)
2. (GMP, FDA available)
3. Cosmetic Peptide (More than 100 kinds in stock)
4. Catalog Peptide (More than 3000 kinds in stock)
5. Botanical monomer (2000 kinds available, 98% pure)
Our Advantages: quality stable, good Price and fast delivery
Report: HPLC/ Mass/ COA/ NMR .
If you have interest in any of our service, please give us a chance for quotation. We will return you a surprise.