Product Information Name: Penetratin C.A.S No. : 214556-79-3 Peptide sequence: RQIKIWFQNRRMKWKK Molecular formula: C₁₀₄H₁₆₉N₃₅O₁₉S Molecular weight : 2245.78 Purity: 98.0% Source: synthetic MSDS and COA: ... Read More

2023-11-07 11:13:33

Custom peptide white color Dalargin peptide enkephalin
Contact Now

Product Information Sequence: H-Tyr-D-Ala-Gly-Phe-Leu-Arg-OH Molecular formula: C35H51N9O6 Molecular weight: 725.85 Quantity in stock : 10 grams Purity: >98.0% Packing : According to clients’ requirements ... Read More

2023-11-07 10:58:45

Custom peptide white color PNC-27 and 28, containing HDM-2-protein-binding
Contact Now

Product Information Product name: PNC-27 Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG M.W: 4031.7 M.F.: C188H293N53O44S Purity: 95% Counter ion: Acetate Format: Lyophilized powder Shelf Life 2 years Apperance ... Read More

2023-11-07 10:57:47

Custom peptide white color solasodine rhamnosyl glycoside Solasonine Solamargine Solasodine.
Contact Now

Product Information Solasodine rhamnosyl glycoside Cat. No.: YS0205 CAS Number: 19121-58-5 M. F.: C45H73NO16 M. W.: 884.07 Batch No.: 20170701 Batch quantity: 50 g Report date: 2017-07-01 Analytical result Test ... Read More

2023-11-07 10:56:02

Custom peptide white color Vasoactive Intestinal Peptide /40077-57-4
Contact Now

Product Information Sequence: His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 Molecular formula: C147H238N44O42S Molecular weight: 3325.80 ... Read More

2023-11-07 10:53:24

Custom peptide white colorVasopressin, Vasopressina, vasopressine
Contact Now

Product Information Name: Vasopressin, Vasopressina, vasopressine Cas No: 11000-17-2 Formula: C43H67N15O12S2 Molecular: 1050.21 Sequence:1-[19-amino-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-13-butan-2-yl... Read More

2023-11-07 10:52:15

Custom peptide white color Noopept CAS:157115-85-0 GSV-111
Contact Now

Product Information Molecular formula C17H22N2O4 Molecular weight 318.37 CAS NO. 157115-85-0 Description: Noopept is the brand name for N-phenylacetyl-L-prolylglycine ethyl ester; In Russia, where Noopept was ... Read More

2023-11-07 10:49:20

Custom peptide white color Magainin 2 CAS:108433-95-0
Contact Now

Product Information Name: Magainin 1 CAS No. : 108433-99-4 Sequence : GIGKFLHSAGKFGKAFVGEIMKS Molecular formula: C112H177N29O28S Molecular weight : 2409.9 Name: Magainin 2 CAS No. : 108433-95-0 Sequence : ... Read More

2023-11-07 10:48:35

Custom peptide white color Omiganan CAS:204248-78-2
Contact Now

Product Information Name: Omiganan CAS No. : 204248-78-2 Sequence : ILRWPWWPWRRK-NH2 Molecular formula: C₉₀H₁₂₇N₂₇O₁₂ Molecular weight : 1779.15 Omiganan is a cationic antimicrobial peptide. Omiganan as an ... Read More

2023-11-07 10:47:42

Custom peptide white color Argipressin Acetate CAS:129979-57-3
Contact Now

Product Information Name:Argipressin Acetate,(Arg8)-Vasopressin Cas No: 113-79-1 (net), 129979-57-3(acetate) Formula: C48H69N15O14S2 Molecular:1144.23 Sequence: H-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH₂ acetate ... Read More

2023-11-07 10:46:45

Page 6 of 22|< << 1 2 3 4 5 6 7 8 9 10 >> >|