Place of Origin: | China |
Brand Name: | Youngshe |
Certification: | / |
Model Number: | high quality |
Minimum Order Quantity: | 1g |
---|---|
Price: | USD50-5000/g |
Packaging Details: | plastic bottle,1g/bottle,5g/bottle,10g/bottle, or according to the customer's request. |
Delivery Time: | 3-5 working days |
Payment Terms: | L/C, T/T, Western Union, MoneyGram |
Supply Ability: | 300g/month |
Reference:: | PNC-27 And 28, Containing HDM-2-protein-binding | Shelf Life: | Two Years |
---|---|---|---|
Color: | White |
Product Information
Product name: PNC-27
Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
M.W: 4031.7
M.F.: C188H293N53O44S
Purity: 95%
Counter ion: Acetate
Format: Lyophilized powder
Shelf Life | 2 years |
Apperance | White Powder |
Purity(by HPLC) | ≥95% |
Company Information
Chengdu Youngshe Chemical Co.,Ltd, is a dynamic and progressive peptides manufacturer in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on peptides.Hi-new tech Zone campus in the suburb of Chengdu city provides Youngshe with a good infrastructure for both industrial-scale production of peptides and custom peptide synthesis.You can select more than 200 kinds of raw cosmetic peptide ingredients here.Youngshe provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.
Our Advantages
1.Competitive factory price.
2. Professionalism of production: With more than 10 years of experience in peptide production
3. Professionalism of product efficacy: We are familiar with thousands of peptides that are now available worldwide, thorough research.
4. Professionalism of service:customer satisfaction is our greatest work.
5. Reliability: We always believe that only good reputation and product quality can make a good company.
6. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
7. Variety of products: We offer more than 200 cosmetic peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide, Octapeptide, Nonapeptide, Decapeptide, Copper peptide, Oligopeptide and so on.
Packing&Shipping
F&Q
Q1: How do I make an order?
A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.
Q2: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
Transfer),Western Union or Paypal.
Q3: How about delivery lead time?
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
Q4:Is there a discount?
A:Different quantity has different discount.
Q5: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
we will send you free goods for replacement or refund your loss.
TRH, Thyroliberin | 24305-27-9 | Pyr-His-Pro-NH2 | ||||||||||
Prepro-TRH (178-199) | 122018-92-2 | H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly-Glu-Gly-Val-Leu-Met-Pro-Glu-OH | ||||||||||
Cyclo(His-Pro) | 53109-32-3 | Cyclo(His-Pro) | ||||||||||
Thymosin β10 (human, rat) | 88160-82-1 | Ac-Ala-Asp-Lys-Pro-Asp-Met-Gly-Glu-Ile-Ala-Ser-Phe-Asp-Lys-Ala-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Thr-Leu-Pro-Thr-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Arg-Ser-Glu-Ile-Ser-OH | ||||||||||
Thymosin β4 (human, bovine, horse, rat) | 77591-33-4 | Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH | ||||||||||
Thymosin α1 (deacetylated) (human, bovine, mouse, rat) | 74221-77-5 | H-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH | ||||||||||
Thymosin α1, Thymalfasin | 62304-98-7 | Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH | ||||||||||
Thymosin β4 (1-4) | 127103-11-1 | Ac-Ser-Asp-Lys-Pro-OH | ||||||||||
Thymopoietin II (34-36) | 75958-14-4 | H-Asp-Val-Tyr-OH | ||||||||||
Thymopoietin II (33-36) | 75957-56-1 | H-Lys-Asp-Val-Tyr-OH | ||||||||||
ThymopoietinII(32-36)-ethyl ester | 283167-49-7 | H-Arg-Lys-Asp-Val-Tyr-OEt | ||||||||||
Thymopoietin II (32-35) | 85466-18-8 | H-Arg-Lys-Asp-Val-OH | ||||||||||
Thymopoietin II (32-34) | 85465-82-3 | H-Arg-Lys-Asp-OH | ||||||||||
Thymopentin | 177966-81-3 | H-Arg-Lys-Asp-Val-Tyr-OH | ||||||||||
LSAL | 169249-03-0 | H-Leu-Ser-Ala-Leu-OH | ||||||||||
Thrombospondin-1 (1016-1023) (human, bovine, mouse) | 149234-04-8 | H-Arg-Phe-Tyr-Val-Val-Met-Trp-Lys-OH | ||||||||||
Thrombospondin-1 (1016-1021) (human, bovine, mouse) | 149234-06-0 | H-Arg-Phe-Tyr-Val-Val-Met-OH |
Contact info.
Cecilia
Email: cecilia@youngshechem.com
Tel/whatsapp/Skype/WeChat: +8618108235634