logo
Send Message
Sales & Support : Request A Quote
Home Products

Custom Peptide Synthesis

All Products
Anti Wrinkle Peptide (103)
Peptide Hair Growth (33)
Skin Care Peptide (73)
Peptide For Eye Bags (6)
Skin Repair Peptide (33)
Peptides Ingredients (341)
Custom Peptide Synthesis (211)
I'm Online Chat Now
China Peptide synthesis white color Thymosin β4 (1-4) / 127103-11-1 with high quality distributor
Peptide synthesis white color Thymosin β4 (1-4) / 127103-11-1 with high quality

Custom Peptide Synthesis

(211)
China Chinese directly supply with high quality white powder AAA-Ome CAS84794-58-1 factory

Chinese directly supply with high quality white powder AAA-Ome CAS84794-58-1
Contact Now

Product Information AAA-Ome CAS No.: 84794-58-1 Molecular formula: C12H23N3O6 Molecular Weight: 305.33 Amino acids sequence: H-Ala-Ala-Ala-Ome Notes: For research use only Shelf Life 2 years Apperance White ... Read More
2023-11-08 14:26:51
China White color custom service D-Arg-Dmt-Lys-Phe-NH2 / SS-31 peptide factory

White color custom service D-Arg-Dmt-Lys-Phe-NH2 / SS-31 peptide
Contact Now

Name:szeto-schiller peptides/SS-31 Cas No: N/A Formula: C50H69N15O9 Molecular:1024 Sequence: D-Arg-Dmt-Lys-Phe-NH2 Purity:98% Appearance: white powder Source: synthetic 3.Others: Payment: T/T,PayPal,Western ... Read More
2023-11-07 13:47:46
China Chinese directly supply white color powder TB-500( frag Thymosin beta-4) with high quality factory

Chinese directly supply white color powder TB-500( frag Thymosin beta-4) with high quality
Contact Now

oduct Information Name: Thymosin β4 Acetate Cas No: 77591-33-4 Formula: C212H350N56O78S Molecular: 4963.49 Sequence:Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln... Read More
2023-11-07 11:23:29
China Custom peptide white color Penetratin peptide CAS.214556-79-3 factory

Custom peptide white color Penetratin peptide CAS.214556-79-3
Contact Now

Product Information Name: Penetratin C.A.S No. : 214556-79-3 Peptide sequence: RQIKIWFQNRRMKWKK Molecular formula: C₁₀₄H₁₆₉N₃₅O₁₉S Molecular weight : 2245.78 Purity: 98.0% Source: synthetic MSDS and COA: ... Read More
2023-11-07 11:13:33
China Custom peptide white color Dalargin peptide enkephalin factory

Custom peptide white color Dalargin peptide enkephalin
Contact Now

Product Information Sequence: H-Tyr-D-Ala-Gly-Phe-Leu-Arg-OH Molecular formula: C35H51N9O6 Molecular weight: 725.85 Quantity in stock : 10 grams Purity: >98.0% Packing : According to clients’ requirements ... Read More
2023-11-07 10:58:45
China Custom peptide white color PNC-27 and 28, containing HDM-2-protein-binding factory

Custom peptide white color PNC-27 and 28, containing HDM-2-protein-binding
Contact Now

Product Information Product name: PNC-27 Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG M.W: 4031.7 M.F.: C188H293N53O44S Purity: 95% Counter ion: Acetate Format: Lyophilized powder Shelf Life 2 years Apperance ... Read More
2023-11-07 10:57:47
China Custom peptide white color solasodine rhamnosyl glycoside Solasonine Solamargine Solasodine. factory

Custom peptide white color solasodine rhamnosyl glycoside Solasonine Solamargine Solasodine.
Contact Now

Product Information Solasodine rhamnosyl glycoside Cat. No.: YS0205 CAS Number: 19121-58-5 M. F.: C45H73NO16 M. W.: 884.07 Batch No.: 20170701 Batch quantity: 50 g Report date: 2017-07-01 Analytical result Test ... Read More
2023-11-07 10:56:02
China Custom peptide white color Vasoactive Intestinal Peptide /40077-57-4 factory

Custom peptide white color Vasoactive Intestinal Peptide /40077-57-4
Contact Now

Product Information Sequence: His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 Molecular formula: C147H238N44O42S Molecular weight: 3325.80 ... Read More
2023-11-07 10:53:24
China Custom peptide white colorVasopressin, Vasopressina, vasopressine factory

Custom peptide white colorVasopressin, Vasopressina, vasopressine
Contact Now

Product Information Name: Vasopressin, Vasopressina, vasopressine Cas No: 11000-17-2 Formula: C43H67N15O12S2 Molecular: 1050.21 Sequence:1-[19-amino-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-13-butan-2-yl... Read More
2023-11-07 10:52:15
China Custom peptide white color Noopept CAS:157115-85-0 GSV-111 factory

Custom peptide white color Noopept CAS:157115-85-0 GSV-111
Contact Now

Product Information Molecular formula C17H22N2O4 Molecular weight 318.37 CAS NO. 157115-85-0 Description: Noopept is the brand name for N-phenylacetyl-L-prolylglycine ethyl ester; In Russia, where Noopept was ... Read More
2023-11-07 10:49:20
Page 7 of 22|< 2 3 4 5 6 7 8 9 10 11 >|
Peptide Hair Growth

High quality blue color cosmetic ingredient GHK-CU,Copper peptide

White Color Peptide Hair Growth No Side Effect Acetyl Tetrapeptide-3

Peptide Hair Growth White Powder Biotinoyl Tripeptide-1/Procapil

Skin Care Peptide

Cosmetic Skin Care Peptide Acetyl Hexapeptide-38 For Breast Enlargement

Peptides Ingredients

White powder peptide FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

White color Factory Supply good price Oxytocin / Oxytocin acetate

White color Custom peptide Deslorelin / Deslorelin Acetate for veterinary use

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

Request A Quote

E-Mail | Sitemap

Mobile Site
Privacy Policy | China Good Quality Anti Wrinkle Peptide Supplier. © 2017 - 2024 youngshececilia.com. All Rights Reserved.