logo
Send Message
Home ProductsCustom Peptide Synthesis

Custom peptide white color PNC-27 and 28, containing HDM-2-protein-binding

Custom peptide white color PNC-27 and 28, containing HDM-2-protein-binding

    • Custom peptide white color PNC-27 and 28, containing HDM-2-protein-binding
    • Custom peptide white color PNC-27 and 28, containing HDM-2-protein-binding
  • Custom peptide white color PNC-27 and 28, containing HDM-2-protein-binding

    Product Details:

    Place of Origin: China
    Brand Name: Youngshe
    Certification: /
    Model Number: high quality

    Payment & Shipping Terms:

    Minimum Order Quantity: 1g
    Price: USD50-5000/g
    Packaging Details: plastic bottle,1g/bottle,5g/bottle,10g/bottle, or according to the customer's request.
    Delivery Time: 3-5 working days
    Payment Terms: L/C, T/T, Western Union, MoneyGram
    Supply Ability: 300g/month
    Contact Now
    Detailed Product Description
    Reference:: PNC-27 And 28, Containing HDM-2-protein-binding Shelf Life: Two Years
    Color: White

    Product Information

     

    Product name: PNC-27

    Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

    M.W: 4031.7

    M.F.: C188H293N53O44S

    Purity: 95%

    Counter ion: Acetate

    Format: Lyophilized powder

     

     

     

    Shelf Life 2 years
    Apperance White Powder
    Purity(by HPLC) ≥95%

     

    Company Information

    Chengdu Youngshe Chemical Co.,Ltd, is a dynamic and progressive peptides manufacturer in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on peptides.Hi-new tech Zone campus in the suburb of Chengdu city provides Youngshe with a good infrastructure for both industrial-scale production of peptides and custom peptide synthesis.You can select more than 200 kinds of raw cosmetic peptide ingredients here.Youngshe provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.
    Bombesin CAS:31362-50-2

    Our Advantages

    1.Competitive factory price.
    2. Professionalism of production: With more than 10 years of experience in peptide production
    3. Professionalism of product efficacy: We are familiar with thousands of peptides that are now available worldwide, thorough research.
    4. Professionalism of service:customer satisfaction is our greatest work.
    5. Reliability: We always believe that only good reputation and product quality can make a good company.
    6. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
    7. Variety of products: We offer more than 200 cosmetic peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide, Octapeptide, Nonapeptide, Decapeptide, Copper peptide, Oligopeptide and so on.

    Packing&Shipping
    Bombesin CAS:31362-50-2

    F&Q

    Q1: How do I make an order?
    A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.


    Q2: How to start orders or make payments?
    A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
    Transfer),Western Union or Paypal.


    Q3: How about delivery lead time?
    A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)


    Q4:Is there a discount?
    A:Different quantity has different discount.


    Q5: How do you treat quality complaint?
    A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
    we will send you free goods for replacement or refund your loss.

     

    TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2                    
    Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly-Glu-Gly-Val-Leu-Met-Pro-Glu-OH                    
    Cyclo(His-Pro) 53109-32-3 Cyclo(His-Pro)                    
    Thymosin β10 (human, rat) 88160-82-1 Ac-Ala-Asp-Lys-Pro-Asp-Met-Gly-Glu-Ile-Ala-Ser-Phe-Asp-Lys-Ala-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Thr-Leu-Pro-Thr-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Arg-Ser-Glu-Ile-Ser-OH                    
    Thymosin β4 (human, bovine, horse, rat) 77591-33-4 Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH                    
    Thymosin α1 (deacetylated) (human, bovine, mouse, rat) 74221-77-5 H-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH                    
    Thymosin α1, Thymalfasin 62304-98-7 Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH                    
    Thymosin β4 (1-4) 127103-11-1 Ac-Ser-Asp-Lys-Pro-OH                    
    Thymopoietin II (34-36) 75958-14-4 H-Asp-Val-Tyr-OH                    
    Thymopoietin II (33-36) 75957-56-1 H-Lys-Asp-Val-Tyr-OH                    
    ThymopoietinII(32-36)-ethyl ester 283167-49-7 H-Arg-Lys-Asp-Val-Tyr-OEt                    
    Thymopoietin II (32-35) 85466-18-8 H-Arg-Lys-Asp-Val-OH                    
    Thymopoietin II (32-34) 85465-82-3 H-Arg-Lys-Asp-OH                    
    Thymopentin 177966-81-3 H-Arg-Lys-Asp-Val-Tyr-OH                    
    LSAL 169249-03-0 H-Leu-Ser-Ala-Leu-OH                    
    Thrombospondin-1 (1016-1023) (human, bovine, mouse) 149234-04-8 H-Arg-Phe-Tyr-Val-Val-Met-Trp-Lys-OH                    
    Thrombospondin-1 (1016-1021) (human, bovine, mouse) 149234-06-0 H-Arg-Phe-Tyr-Val-Val-Met-OH
     



    Contact info.
    Cecilia
    Email: cecilia@youngshechem.com
    Tel/whatsapp/Skype/WeChat: +8618108235634

    Contact Details
    Chengdu YoungShe Chemical Co., Ltd

    Contact Person: Cecilia Jiang

    Tel: +8618108235634

    Send your inquiry directly to us (0 / 3000)