logo
Send Message
Home ProductsPeptides Ingredients

high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide

high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide

    • high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide
    • high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide
    • high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide
    • high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide
    • high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide
  • high quality white color Senolytics / FOXO4 D-Retro-Inverso peptide

    Product Details:

    Place of Origin: China
    Brand Name: youngshe
    Certification: coa
    Model Number: top grade

    Payment & Shipping Terms:

    Minimum Order Quantity: 0.1g
    Price: 100USD-6000USD/g
    Packaging Details: plastic bottles
    Delivery Time: 3-5 working days
    Payment Terms: L/C, T/T, Western Union, MoneyGram
    Supply Ability: 10g/month
    Contact Now
    Detailed Product Description
    Color: White Shelf Life: 2 Years

    FOXO4-DRI

     

    Product Description

     

    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
     
    Packaging & Shipping

     1g per bottle (plastic bottle or glass bottle) or customized, Protected by bubble film and sealed in a carton/bag

    Company Information

    Chengdu YoungShe Chemical Co Ltd is the largest cosmetic peptide supplier in China.We are dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.

     

    YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult. 

    Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.

     

    Cecilia@youngshechem.com

    Contact Details
    Chengdu YoungShe Chemical Co., Ltd

    Contact Person: Cecilia Jiang

    Tel: +8618108235634

    Send your inquiry directly to us (0 / 3000)