| Place of Origin: | China |
| Brand Name: | Youngshe |
| Certification: | / |
| Model Number: | High quality |
| Minimum Order Quantity: | 100mg |
|---|---|
| Price: | USD50-300/g |
| Packaging Details: | plastic bottle,1g/bottle, 10g/ bottle or according to the customer's requirements |
| Delivery Time: | 3-5 working days |
| Payment Terms: | L/C, T/T, Western Union, MoneyGram |
| Supply Ability: | 300g/month |
| Color: | White | Shelf Life: | Two Years |
|---|---|---|---|
| Purity: | 98% |
Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color
Name:Enfuvirtide Acetate
Cas No: 159519-65-0
Formular: C204H301N51O64
Molecular:4491.87
Sequence: AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Pentafuside, Fuzeon, DP178, T-20, T 20 (peptide), Dp 178
1. Send us your request
2.Confirm price,delivery time,payment term,your request and all details you care
3.Sign contract and invoice
4.Payment by your side
5.We arrange shipment( immediately after confim payment)
6.Delivery( door to door,around 5 working days)
7.Follow-up service
1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.
| ACTH (1-10) | 2791-5-1 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-OH | |||||||||
| ACTH (1-13) | 22006-64-0 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-OH | |||||||||
| ACTH (1-14) | 25696-21-3 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-OH | |||||||||
| ACTH (1-16) | 5576-42-1 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-OH | |||||||||
| ACTH (1-17) | 7266-47-9 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH | |||||||||
| ACTH (1-24) (human, bovine, rat) | 16960-16-0 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH | |||||||||
| (D-Lys16)-ACTH (1-24) (human, bovine, rat) | 494750-52-6 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-D-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH | |||||||||
| (Phe2,Nle4)-ACTH (1-24) (human, bovine, rat) | 97773-00-7 | H-Ser-Phe-Ser-Nle-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH | |||||||||
| (D-Ser1)-ACTH (1-24) (human, bovine, rat) | 26469-81-8 | H-D-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH | |||||||||
| ACTH (1-39) (guinea pig) | 111524-36-8 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Ala-Asn-Gly-Ala-Glu-Glu-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH | |||||||||
| ACTH (1-39) (human), Corticotropin | 12279-41-3 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH | |||||||||
| ACTH (1-39) (mouse, rat) | 77465-10-2 | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH | |||||||||
| ACTH (2-24) (human, bovine, rat) | 67654-32-4 | H-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH | |||||||||
| ACTH (4-9) | 56236-83-0 | H-Met-Glu-His-Phe-Arg-Trp-OH | |||||||||
| (Met(O)4,D-Lys8,Phe9)-ACTH (4-9) | 50913-93-4 | H-Met(O)-Glu-His-Phe-D-Lys-Phe-OH | |||||||||
| Tyr-ACTH (4-9) | 129813-57-6 | H-Tyr-Met-Glu-His-Phe-Arg-Trp-OH | |||||||||
| ACTH (4-10), α-MSH (4-10) | 4037-1-8 | H-Met-Glu-His-Phe-Arg-Trp-Gly-OH | |||||||||
| Tyr-ACTH (4-10) | 131374-17-9 | H-Tyr-Met-Glu-His-Phe-Arg-Trp-Gly-OH | |||||||||
| ACTH (4-11) | 67224-41-3 | H-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-OH | |||||||||
| ACTH (5-10) | 4086-29-7 | H-Glu-His-Phe-Arg-Trp-Gly-OH | |||||||||
| ACTH (7-38) (human) | 68563-24-6 | H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH | |||||||||
| ACTH (11-24) | 4237-93-8 | H-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH |
We are a professional Peptide Manufacturer in China. We can do :
1. Custom peptide synthesis ( long peptide sequence up to 200AA)
2. (GMP, FDA available)
3. Cosmetic Peptide (More than 100 kinds in stock)
4. Catalog Peptide (More than 3000 kinds in stock)
5. Botanical monomer (2000 kinds available, 98% pure)