logo
Send Message
Home ProductsPeptides Ingredients

Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color

Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color

    • Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color
    • Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color
    • Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color
    • Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color
  • Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color

    Product Details:

    Place of Origin: China
    Brand Name: Youngshe
    Certification: /
    Model Number: High quality

    Payment & Shipping Terms:

    Minimum Order Quantity: 100mg
    Price: USD50-300/g
    Packaging Details: plastic bottle,1g/bottle, 10g/ bottle or according to the customer's requirements
    Delivery Time: 3-5 working days
    Payment Terms: L/C, T/T, Western Union, MoneyGram
    Supply Ability: 300g/month
    Contact Now
    Detailed Product Description
    Color: White Shelf Life: Two Years
    Purity: 98%

    Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color

     

     

     

    Name:Enfuvirtide Acetate

    Cas No: 159519-65-0

    Formular: C204H301N51O64

    Molecular:4491.87

    Sequence: AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2

    Purity:98%

    Appearance: white powder

    Source: synthetic

    Also known as: Pentafuside, Fuzeon, DP178, T-20, T 20 (peptide), Dp 178

     

     

     

    Order process

    1. Send us your request

    2.Confirm price,delivery time,payment term,your request and all details you care

    3.Sign contract and invoice

    4.Payment by your side

    5.We arrange shipment( immediately after confim payment)

    6.Delivery( door to door,around 5 working days)

    7.Follow-up service

     

     

    Packing

    1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.

     

     

    ACTH (1-10) 2791-5-1 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-OH                  
    ACTH (1-13) 22006-64-0 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-OH                  
    ACTH (1-14) 25696-21-3 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-OH                  
    ACTH (1-16) 5576-42-1 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-OH                  
    ACTH (1-17) 7266-47-9 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH                  
    ACTH (1-24) (human, bovine, rat) 16960-16-0 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH                  
    (D-Lys16)-ACTH (1-24) (human, bovine, rat) 494750-52-6 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-D-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH                  
    (Phe2,Nle4)-ACTH (1-24) (human, bovine, rat) 97773-00-7 H-Ser-Phe-Ser-Nle-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH                  
    (D-Ser1)-ACTH (1-24) (human, bovine, rat) 26469-81-8 H-D-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH                  
    ACTH (1-39) (guinea pig) 111524-36-8 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Ala-Asn-Gly-Ala-Glu-Glu-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH                  
    ACTH (1-39) (human), Corticotropin 12279-41-3 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH                  
    ACTH (1-39) (mouse, rat) 77465-10-2 H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH                  
    ACTH (2-24) (human, bovine, rat) 67654-32-4 H-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH                  
    ACTH (4-9) 56236-83-0 H-Met-Glu-His-Phe-Arg-Trp-OH                  
    (Met(O)4,D-Lys8,Phe9)-ACTH (4-9) 50913-93-4 H-Met(O)-Glu-His-Phe-D-Lys-Phe-OH                  
    Tyr-ACTH (4-9) 129813-57-6 H-Tyr-Met-Glu-His-Phe-Arg-Trp-OH                  
    ACTH (4-10), α-MSH (4-10) 4037-1-8 H-Met-Glu-His-Phe-Arg-Trp-Gly-OH                  
    Tyr-ACTH (4-10) 131374-17-9 H-Tyr-Met-Glu-His-Phe-Arg-Trp-Gly-OH                  
    ACTH (4-11) 67224-41-3 H-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-OH                  
    ACTH (5-10) 4086-29-7 H-Glu-His-Phe-Arg-Trp-Gly-OH                  
    ACTH (7-38) (human) 68563-24-6 H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH                  
    ACTH (11-24) 4237-93-8 H-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH                  

     

     

     

    We are a professional Peptide Manufacturer in China. We can do :

    1. Custom peptide synthesis ( long peptide sequence up to 200AA)
    2. (GMP, FDA available)
    3. Cosmetic Peptide (More than 100 kinds in stock)
    4. Catalog Peptide (More than 3000 kinds in stock)
    5. Botanical monomer (2000 kinds available, 98% pure)

     
    For more peptide information,please contact:
    Chemical material Enfuvirtide Acetate / CAS 159519-65-0 in white color

     

     

     

    Contact Details
    Chengdu YoungShe Chemical Co., Ltd

    Contact Person: Cecilia Jiang

    Tel: +8618108235634

    Send your inquiry directly to us (0 / 3000)