Place of Origin: | China |
Brand Name: | Youngshe |
Certification: | / |
Model Number: | High purity |
Minimum Order Quantity: | 0.1g |
---|---|
Price: | USD1-200 |
Packaging Details: | plastic bottle,1g/bottle,5g/bottle,10g/bottle, or according to the customer's request. |
Delivery Time: | 2-3days |
Payment Terms: | L/C, T/T,, Western Union,Paypal |
Supply Ability: | 500g/month |
Usage: | Cosmetic Ingredient | Shelf Life: | 2 Years |
---|---|---|---|
Color: | White Powder |
Product Information
Name: ACTH(1-39), Corticotropin
Cas No: 9002-60-2
Formula: C207H308N56O58S
Molecular: 4541.0658
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Adrenocorticotropin, ACTH, Corticotrophine, Corticotrofina, Cortrophin, Corticotrophinum
Note: For lab research use only
Shelf Life | 2 years |
Apperance | White Powder |
Purity(by HPLC) | ≥95% |
Company Information
Chengdu Youngshe Chemical Co.,Ltd, is a dynamic and progressive peptides manufacturer in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on peptides.Hi-new tech Zone campus in the suburb of Chengdu city provides Youngshe with a good infrastructure for both industrial-scale production of peptides and custom peptide synthesis.You can select more than 200 kinds of raw cosmetic peptide ingredients here.Youngshe provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.
Our Advantages
1.Competitive factory price.
2. Professionalism of production: With more than 10 years of experience in peptide production
3. Professionalism of product efficacy: We are familiar with thousands of peptides that are now available worldwide, thorough research.
4. Professionalism of service:customer satisfaction is our greatest work.
5. Reliability: We always believe that only good reputation and product quality can make a good company.
6. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
7. Variety of products: We offer more than 200 cosmetic peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide, Octapeptide, Nonapeptide, Decapeptide, Copper peptide, Oligopeptide and so on.
Packing&Shipping
F&Q
Q1: How do I make an order?
A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.
Q2: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
Transfer),Western Union or Paypal.
Q3: How about delivery lead time?
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
Q4:Is there a discount?
A:Different quantity has different discount.
Q5: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
we will send you free goods for replacement or refund your loss.
Contact info.
Cecilia
Email: cecilia@youngshechem.com
Tel/whatsapp/Skype/WeChat: +8108235634