logo
Send Message
Home ProductsCustom Peptide Synthesis

High quality ACTH(1-39) CAS:9002-60-2 white powder in stock

High quality ACTH(1-39) CAS:9002-60-2 white powder in stock

    • High quality ACTH(1-39) CAS:9002-60-2 white powder in stock
    • High quality ACTH(1-39) CAS:9002-60-2 white powder in stock
    • High quality ACTH(1-39) CAS:9002-60-2 white powder in stock
    • High quality ACTH(1-39) CAS:9002-60-2 white powder in stock
  • High quality ACTH(1-39) CAS:9002-60-2 white powder in stock

    Product Details:

    Place of Origin: China
    Brand Name: Youngshe
    Certification: /
    Model Number: High purity

    Payment & Shipping Terms:

    Minimum Order Quantity: 0.1g
    Price: USD1-200
    Packaging Details: plastic bottle,1g/bottle,5g/bottle,10g/bottle, or according to the customer's request.
    Delivery Time: 2-3days
    Payment Terms: L/C, T/T,, Western Union,Paypal
    Supply Ability: 500g/month
    Contact Now
    Detailed Product Description
    Usage: Cosmetic Ingredient Shelf Life: 2 Years
    Color: White Powder

    Product Information

     

    Name: ACTH(1-39), Corticotropin

    Cas No: 9002-60-2

    Formula: C207H308N56O58S

    Molecular: 4541.0658

    Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF

    Purity:98%

    Appearance: white powder

    Source: synthetic

    Also known as: Adrenocorticotropin, ACTH, Corticotrophine, Corticotrofina, Cortrophin, Corticotrophinum

     

    Note: For lab research use only

     

    Shelf Life 2 years
    Apperance White Powder
    Purity(by HPLC) ≥95%

     

    Company Information

    Chengdu Youngshe Chemical Co.,Ltd, is a dynamic and progressive peptides manufacturer in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on peptides.Hi-new tech Zone campus in the suburb of Chengdu city provides Youngshe with a good infrastructure for both industrial-scale production of peptides and custom peptide synthesis.You can select more than 200 kinds of raw cosmetic peptide ingredients here.Youngshe provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.
    PEG-MGF Peptide Synthesis

    Our Advantages

    1.Competitive factory price.
    2. Professionalism of production: With more than 10 years of experience in peptide production
    3. Professionalism of product efficacy: We are familiar with thousands of peptides that are now available worldwide, thorough research.
    4. Professionalism of service:customer satisfaction is our greatest work.
    5. Reliability: We always believe that only good reputation and product quality can make a good company.
    6. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
    7. Variety of products: We offer more than 200 cosmetic peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide, Octapeptide, Nonapeptide, Decapeptide, Copper peptide, Oligopeptide and so on.

    Packing&Shipping
    PEG-MGF Peptide Synthesis

    F&Q

    Q1: How do I make an order?
    A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.


    Q2: How to start orders or make payments?
    A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
    Transfer),Western Union or Paypal.


    Q3: How about delivery lead time?
    A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)


    Q4:Is there a discount?
    A:Different quantity has different discount.


    Q5: How do you treat quality complaint?
    A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
    we will send you free goods for replacement or refund your loss.



    Contact info.
    Cecilia
    Email: cecilia@youngshechem.com
    Tel/whatsapp/Skype/WeChat: +8108235634

    Contact Details
    Chengdu YoungShe Chemical Co., Ltd

    Contact Person: Cecilia Jiang

    Tel: +8618108235634

    Send your inquiry directly to us (0 / 3000)