Send Message
Home ProductsPeptides Ingredients

White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer

White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer

    • White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer
    • White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer
    • White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer
    • White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer
    • White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer
    • White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer
  • White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer

    Product Details:

    Place of Origin: China
    Brand Name: Youngshe
    Certification: /
    Model Number: High quality

    Payment & Shipping Terms:

    Minimum Order Quantity: 100mg
    Price: USD50-3000/g
    Packaging Details: plastic bottle,1g/bottle, 10g/ bottle or according to the customer's requirements
    Delivery Time: 3-5 working days
    Payment Terms: L/C, T/T, Western Union, MoneyGram
    Supply Ability: 300g/month
    Contact Now
    Detailed Product Description
    Color: White Shelf Life: Two Years
    Purity: 98%

    White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer

     

     

     

    Cas No:141732-76-5

    Formula: C186H286N50O62S

    Molecular:4246.62

    Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    Purity:98%

    Appearance: white powder

    Source: synthetic

    Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4

     

     

    644

     

     

     

     

     

    ACTH (4-9) 56236-83-0 H-Met-Glu-His-Phe-Arg-Trp-OH
    (Met(O)4,D-Lys8,Phe9)-ACTH (4-9) 50913-93-4 H-Met(O)-Glu-His-Phe-D-Lys-Phe-OH
    Tyr-ACTH (4-9) 129813-57-6 H-Tyr-Met-Glu-His-Phe-Arg-Trp-OH
    ACTH (4-10), α-MSH (4-10) 4037-1-8 H-Met-Glu-His-Phe-Arg-Trp-Gly-OH
    Tyr-ACTH (4-10) 131374-17-9 H-Tyr-Met-Glu-His-Phe-Arg-Trp-Gly-OH
    ACTH (4-11) 67224-41-3 H-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-OH
    ACTH (5-10) 4086-29-7 H-Glu-His-Phe-Arg-Trp-Gly-OH
    ACTH (7-38) (human) 68563-24-6 H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
    ACTH (11-24) 4237-93-8 H-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH
    ACTH (18-39) (human) 53917-42-3 H-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
    ACTH (22-39) 37548-29-1 H-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
    ACTH (34-39) 69454-10-0 H-Ala-Phe-Pro-Leu-Glu-Phe-OH
    ACV 32467-88-2 H-Aad(Cys-D-Val-OH)-OH
    Acyl Carrier Protein (ACP) (65-74) (acid) 66851-75-0 H-Val-Gln-Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly-OH
    Adipokinetic Hormone 99886-31-4 Pyr-Leu-Thr-Phe-Thr-Ser-Ser-Trp-Gly-NH2
    H-Ala-D-Isogln-OH 45159-25-9 H-Ala-D-Glu-NH2
    H-Ala-Glu(OtBu)-NH2 • HCl 108607-07-4 H-Ala-Glu(OtBu)-NH2 · HCl
    Boc-Ala-D-Glu-NH2 18814-50-1 Boc-Ala-D-Glu-NH2
    Boc-Ala-D-Glu-Obzl 50515-48-5 Boc-Ala-D-Glu-Obzl
    Boc-Ala-D-Glu(OBzl)-NH2 18814-49-8 Boc-Ala-D-Glu(OBzl)-NH2

     

     

     

    Order process

    1. Send us your request

    2.Confirm price,delivery time,payment term,your request and all details you care

    3.Sign contract and invoice

    4.Payment by your side

    5.We arrange shipment( immediately after confim payment)

    6.Delivery( door to door,around 5 working days)

    7.Follow-up service

     

     

    Packing

    1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.

     

     

    We are a professional Peptide Manufacturer in China. We can do :

    1. Custom peptide synthesis ( long peptide sequence up to 200AA)
    2. (GMP, FDA available)
    3. Cosmetic Peptide (More than 100 kinds in stock)
    4. Catalog Peptide (More than 3000 kinds in stock)
    5. Botanical monomer (2000 kinds available, 98% pure)

    Our Advantages: quality stable, good Price and fast delivery

    Report: HPLC/ Mass/ COA/ NMR .

    If you have interest in any of our service, please give us a chance for quotation. We will return you a surprise.

     

    For more peptide information,please contact:
    White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer

     

     

     

    Contact Details
    Chengdu YoungShe Chemical Co., Ltd

    Contact Person: Cecilia

    Tel: +8618108235634

    Send your inquiry directly to us (0 / 3000)