Send Message
Sales & Support: Request A Quote
Home Products

Peptides Ingredients

All Products
Anti Wrinkle Peptide (101)
Peptide Hair Growth (33)
Skin Care Peptide (73)
Peptide For Eye Bags (6)
Skin Repair Peptide (33)
Peptides Ingredients (343)
Custom Peptide Synthesis (211)
Best Products
Good quality white color Epitalon / N-Acetyl Epitalon / N-Acetyl Epitalon Amidate

Good quality white color Epitalon / N-Acetyl Epitalon / N-Acetyl Epitalon Amidate

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

Pure Arg bpc-157 for bodybuilding purpose from Chinese factory

Pure Arg bpc-157 for bodybuilding purpose from Chinese factory

I'm Online Chat Now
China Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color distributor
Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color

Peptides Ingredients

(343)
China Melanophore-Stimulating Hormone,LS-187036,Melanotropin,cas 581-05-5 in white color factory

Melanophore-Stimulating Hormone,LS-187036,Melanotropin,cas 581-05-5 in white color
Contact Now

α-Melanotropin (human) Acetate 1.Basic information: Product Name:α-Melanotropin (human) Acetate Synonym: α-MSH; α-Melanocyte-stimulating hormone;Melanophore-Stimulating Hormone;Melanophore Stimulating Hormone;α ... Read More
2023-10-31 09:42:13
China White color high pure Sermorelin Acetate powder with fast delivery from China factory

White color high pure Sermorelin Acetate powder with fast delivery from China
Contact Now

Sermorelin Acetate name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder ... Read More
2023-10-31 09:42:13
China Manufacturer supply HNG Peptide (human)/S14G-Humanin CAS 330936-70-4 with high purity in white color factory

Manufacturer supply HNG Peptide (human)/S14G-Humanin CAS 330936-70-4 with high purity in white color
Contact Now

Manufacturer supply HNG Peptide (human)/S14G-Humanin CAS 330936-70-4 Name: HNG Peptide (human) CAS No. : 330936-70-4 Sequence:H-Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val... Read More
2023-10-31 09:42:13
China White color Palmitoyl Tripeptide-30 melatime for DNA damage and UV damage from reliable Chinese manufacturer factory

White color Palmitoyl Tripeptide-30 melatime for DNA damage and UV damage from reliable Chinese manufacturer
Contact Now

White color Palmitoyl Tripeptide-30 melatime for DNA damage and UV damage from reliable Chinese manufacturer 1.Basic information: INCI name: Palmitoyl Tripeptide-30 Reference: melatime Purity: >95% Grade: ... Read More
2023-10-31 09:42:06
China High quality anti-wrinkle cosmetic peptide white color Tripeptide-6 CG-CTP cas951775-32-9 factory

High quality anti-wrinkle cosmetic peptide white color Tripeptide-6 CG-CTP cas951775-32-9
Contact Now

High quality anti-wrinkle cosmetic peptide white color Tripeptide-6 CG-CTP 1.Basic information: INCI Name: Tripeptide-6 Reference: CG-CTP Cas No: 951775-32-9 Formula: C12H19N3O5 Molecular:285.30 Sequence: Pro... Read More
2023-10-31 09:42:06
China Peptide pure white color powder palmitoyl dipeptide-6 with good quality 18684-24-7 factory

Peptide pure white color powder palmitoyl dipeptide-6 with good quality 18684-24-7
Contact Now

Peptide pure white powder palmitoyl dipeptide-6 with good quality 18684-24-7 1.Basic information: INCI name:Dipeptide-6 Cas No: 18684-24-7 MF:C10H16N2O4 Molecular:228.25 Appearance: white to pale yellow powder. ... Read More
2023-10-31 09:42:05
China Factory supply peptide white color powder ACETYL SH-HEPTAPEPTIDE-1 for skin barrier and immune factory

Factory supply peptide white color powder ACETYL SH-HEPTAPEPTIDE-1 for skin barrier and immune
Contact Now

Factory supply peptide white color powder ACETYL SH-HEPTAPEPTIDE-1 for skin barrier and immune 1.Basic information: Name: ACETYL SH-HEPTAPEPTIDE-1 Reference: PerfectionPeptide P7 Cas No: 1395088-14-8 Purity: ... Read More
2023-10-31 09:42:05
China Chinese manufacturer supply white color Myristoyl pentapeptide-11/SymPeptide 225 with high quality factory

Chinese manufacturer supply white color Myristoyl pentapeptide-11/SymPeptide 225 with high quality
Contact Now

Chinese manufacturer supply white color Myristoyl pentapeptide-11/SymPeptide 225 with high quality INCI: Myristoyl Pentapeptide-11 Reference: SymPeptide 225 Additive: 500ppm Odor: no Stability: stable Capacity: ... Read More
2023-10-31 09:42:05
China Skin moisture peptide white color Acetyl Hexapeptide-37 / Diffuporine from reliable Chinese supplier factory

Skin moisture peptide white color Acetyl Hexapeptide-37 / Diffuporine from reliable Chinese supplier
Contact Now

Skin moisture peptide white color Acetyl Hexapeptide-37 / Diffuporine from reliable Chinese supplier 1.Basic information:INCI Name: Acetyl Hexapeptide-37Reference: DiffuporinePurity: >95%Solubility: soluble in ... Read More
2023-10-31 09:42:05
China Anti-inflammatory and irritation white color Acetyl Tetrapeptide-15 from Chinese manufacturer with unimaginable effect factory

Anti-inflammatory and irritation white color Acetyl Tetrapeptide-15 from Chinese manufacturer with unimaginable effect
Contact Now

Anti-inflammatory and irritation whitpeptide Acetyl Tetrapeptide-15 from Chinese manufacturer 1.Basic information: INCI Name: Acetyl Tetrapeptide-15 Reference: Skinasensyl Formula: C34H39N5O6 Molecular: 613.7 ... Read More
2023-10-31 09:42:05
Page 5 of 35|< 1 2 3 4 5 6 7 8 9 10 >|
Peptide Hair Growth

High quality blue color cosmetic ingredient GHK-CU,Copper peptide

White Color Peptide Hair Growth No Side Effect Acetyl Tetrapeptide-3

Peptide Hair Growth White Powder Biotinoyl Tripeptide-1/Procapil

Skin Care Peptide

Cosmetic Skin Care Peptide Acetyl Hexapeptide-38 For Breast Enlargement

Peptides Ingredients

White powder peptide FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

White color Factory Supply good price Oxytocin / Oxytocin acetate

White color Custom peptide Deslorelin / Deslorelin Acetate for veterinary use

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

Request A Quote

E-Mail | Sitemap

Mobile Site
Privacy Policy | China Good Quality Anti Wrinkle Peptide Supplier. © 2017 - 2024 youngshececilia.com. All Rights Reserved.