Send Message
Sales & Support: Request A Quote
Home Products

Peptides Ingredients

All Products
Anti Wrinkle Peptide (101)
Peptide Hair Growth (33)
Skin Care Peptide (73)
Peptide For Eye Bags (6)
Skin Repair Peptide (33)
Peptides Ingredients (343)
Custom Peptide Synthesis (211)
Best Products
Good quality white color Epitalon / N-Acetyl Epitalon / N-Acetyl Epitalon Amidate

Good quality white color Epitalon / N-Acetyl Epitalon / N-Acetyl Epitalon Amidate

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

Pure Arg bpc-157 for bodybuilding purpose from Chinese factory

Pure Arg bpc-157 for bodybuilding purpose from Chinese factory

I'm Online Chat Now
China Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color distributor
Custom chemical services [Gly14]-Humanin (HNG),Humanin (HNG) from Chinese reliable manufacturer in white color

Peptides Ingredients

(343)
China Good quality white color Dermorphin,CAS 77614-16-5 Youngshe Chem factory

Good quality white color Dermorphin,CAS 77614-16-5 Youngshe Chem
Contact Now

Good quality white color Dermorphin,CAS 77614-16-5 Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly-Glu... Read More
2018-05-30 15:48:04
China Good quality white color Retrocyclin-1,CAS 724760-19-4 Youngshe Chem factory

Good quality white color Retrocyclin-1,CAS 724760-19-4 Youngshe Chem
Contact Now

Good quality white color Retrocyclin-1,CAS 724760-19-4 Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly... Read More
2018-05-30 15:47:14
China White color Polypeptide Fertirelin Acetate / Fertirelin from reliable peptide manufacturer factory

White color Polypeptide Fertirelin Acetate / Fertirelin from reliable peptide manufacturer
Contact Now

White color Polypeptide Fertirelin Acetate / Fertirelin from reliable peptide manufacturer Name:Fertirelin Acetate Cas No: 38234-21-8 Formula: C55H76N16O12 Molecular:1153.29 Sequence: Pyr-His-Trp-Ser-Tyr-Gly... Read More
2018-05-23 14:43:05
China White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer factory

White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer
Contact Now

White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98... Read More
2018-05-23 14:41:24
China White color peptides Polypeptide Leuprorelin / Leuprorelin Acetate from Youngshe Chem factory

White color peptides Polypeptide Leuprorelin / Leuprorelin Acetate from Youngshe Chem
Contact Now

White color peptides Polypeptide Leuprorelin / Leuprorelin Acetate from Youngshe Chem Cas No: 53714-56-0 (net), 74381-53-6 (acetate) Formula: C61H88N16O14 Molecular:1269.45 Sequence: Pyr-His-Trp-Ser-Tyr-D-Leu... Read More
2018-05-23 14:39:23
China Good quality white color Ac-IYGEF-NH2 ,CAS 168781-78-0 from Youngshe Chem factory

Good quality white color Ac-IYGEF-NH2 ,CAS 168781-78-0 from Youngshe Chem
Contact Now

Good quality white color Ac-IYGEF-NH2 ,CAS 168781-78-0 from Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu... Read More
2018-05-21 15:59:34
China Good quality white color KFY ,CAS 63958-93-0 from Youngshe Chem factory

Good quality white color KFY ,CAS 63958-93-0 from Youngshe Chem
Contact Now

Good quality white color KFY ,CAS 63958-93-0 from Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly-Glu... Read More
2018-05-21 15:58:24
China Good quality white color Preangiotensinogen (11-14) (human) ,CAS 102813-98-9 from Youngshe Chem factory

Good quality white color Preangiotensinogen (11-14) (human) ,CAS 102813-98-9 from Youngshe Chem
Contact Now

Good quality white color Preangiotensinogen (11-14) (human) ,CAS 102813-98-9 from Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg... Read More
2018-05-21 15:56:44
China Good quality white color PHPFHFFVYK ,CAS 75645-19-1 from Youngshe Chem factory

Good quality white color PHPFHFFVYK ,CAS 75645-19-1 from Youngshe Chem
Contact Now

Good quality white color PHPFHFFVYK ,CAS 75645-19-1 from Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp-Glu-Glu-Lys-Glu-Gly... Read More
2018-05-21 15:55:38
China Good quality white color Pancreatic Polypeptide (rat) ,CAS 90419-12-8 from Youngshe Chem factory

Good quality white color Pancreatic Polypeptide (rat) ,CAS 90419-12-8 from Youngshe Chem
Contact Now

Good quality white color Pancreatic Polypeptide (rat) ,CAS 90419-12-8 from Youngshe Chem TRH, Thyroliberin 24305-27-9 Pyr-His-Pro-NH2 Prepro-TRH (178-199) 122018-92-2 H-Phe-Ile-Asp-Pro-Glu-Leu-Gln-Arg-Ser-Trp... Read More
2018-05-21 15:54:25
Page 22 of 35|< 17 18 19 20 21 22 23 24 25 26 >|
Peptide Hair Growth

High quality blue color cosmetic ingredient GHK-CU,Copper peptide

White Color Peptide Hair Growth No Side Effect Acetyl Tetrapeptide-3

Peptide Hair Growth White Powder Biotinoyl Tripeptide-1/Procapil

Skin Care Peptide

Cosmetic Skin Care Peptide Acetyl Hexapeptide-38 For Breast Enlargement

Peptides Ingredients

White powder peptide FOXO4-D-Retro-Inverso(DRI) from reliable manufacturer

White color Factory Supply good price Oxytocin / Oxytocin acetate

White color Custom peptide Deslorelin / Deslorelin Acetate for veterinary use

competitive price hot selling N-acetyl Semax and Semax lyophilized powder from Chinese factory with high quality

Request A Quote

E-Mail | Sitemap

Mobile Site
Privacy Policy | China Good Quality Anti Wrinkle Peptide Supplier. © 2017 - 2024 youngshececilia.com. All Rights Reserved.