Place of Origin: | China |
Brand Name: | Youngshe |
Certification: | / |
Model Number: | High purity |
Minimum Order Quantity: | 0.1g |
---|---|
Price: | USD1-6000 |
Packaging Details: | plastic bottle,1g/bottle,5g/bottle,10g/bottle, or according to the customer's request. |
Delivery Time: | within 30 days |
Payment Terms: | L/C, T/T, Western Union,Paypal |
Supply Ability: | 200g/month |
Shelf Life: | 2 Years | Purity:: | 90%min |
---|---|---|---|
Color: | White Powder |
FOXO4-DRI
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
1. Send us your request
2.Confirm price,delivery time,payment term,your request and all details you care
3.Sign contract and issue invoice
4.Payment by your side
5.We arrange shipment immediately after confirm payment
6.Delivery( door to door,around 5 working days)
7.Follow-up service
1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.
Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 100 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.
YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.
Since Dec,2014,YoungShe group has expanded their business to botanical cosmetic active ingredient and related.
We will use your favorite courier,such as DHL,UPS,TNT,FEDEX or EMS. Shipping by Air is also available.
Please contact us by:
Cecilia Jiang
Ph:+86-18108235634
What'sapp/We chat:+86-18108235634